PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g003290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 283aa    MW: 30793.6 Da    PI: 8.5723
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g003290.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.2e-18125179256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tk+q   Le+ F+ +++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Csa10g003290.1 125 RKKLRLTKQQSALLEDSFKLHSTLNPKQKQTLARQLNLRPRQVEVWFQNRRARTK 179
                     788899***********************************************98 PP

2HD-ZIP_I/II122.62e-39125214191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rl+k+q++lLE+sF+ +++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke ++L+ +l
  Csa10g003290.1 125 RKKLRLTKQQSALLEDSFKLHSTLNPKQKQTLARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLK-AL 214
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-17113175IPR009057Homeodomain-like
PROSITE profilePS5007117.038121181IPR001356Homeobox domain
SMARTSM003894.1E-15123185IPR001356Homeobox domain
SuperFamilySSF466895.13E-18123189IPR009057Homeodomain-like
PfamPF000462.2E-15125179IPR001356Homeobox domain
CDDcd000861.61E-15125182No hitNo description
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
SMARTSM003401.4E-25181224IPR003106Leucine zipper, homeobox-associated
PfamPF021831.1E-9181215IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGFDDSCNTG LVLGLSLSPA SSNYNHAIKK ASATVDHRFI RLDPSLTLSL SGESYKTKTV  60
AGAGDQICRQ TSSHSGISSF SSGRVKRERE ISGGDGEEEA EETTERVVSS RVSDDHEDEE  120
GVSARKKLRL TKQQSALLED SFKLHSTLNP KQKQTLARQL NLRPRQVEVW FQNRRARTKL  180
KQTEVDCEFL KKCCETLTDE NRRLQKELQD LKALKLAQPF YMHMPAATLT MCPSCERLGG  240
GGGTGGAGGG TAAVDGETAK GAFSIVTKPR FYNPFTNPSA AC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173181RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU093360.0U09336.1 Arabidopsis thaliana clone HAT22 homeobox protein mRNA, complete cds.
GenBankAY0875630.0AY087563.1 Arabidopsis thaliana clone 36691 mRNA, complete sequence.
GenBankBT0023180.0BT002318.1 Arabidopsis thaliana clone C105403 putative homeobox protein HAT22 (At4g37790) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010432030.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466041e-172HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLD7MA031e-171D7MA03_ARALL; Homeobox-leucine zipper protein 22
STRINGfgenesh2_kg.7__270__AT4G37790.11e-170(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-169HD-ZIP family protein